🌎 Versand an: United States
Navigation umschalten
Warenkorb
Suche
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Struktur Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

HCAR3

BeschreibungHydroxycarboxylic acid receptor 3

Gene and Protein Information

Gene ID8843
Uniprot Accession IDs P49019 A8K4G5 B2R830 E9PI97 Q8NGE4
Ensembl ID ENSP00000436714
Symbol GPR109B HCA3 HM74B NIACR2 HCA3 HM74 PUMAG Puma-g GPR109B
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MNRHHLQDHFLEIDKKNCCVFRDDFIAKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWKSSRIFLFNLAVADFLLIICLPFVMDYYVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTVVAVDRYFRVVHPHHALNKISNWTAAIISCLLWGITVGLTVHLLKKKLLIQNGTANVCISFSICHTFRWHEAMFLLEFFLPLGIILFCSARIIWSLRQRQMDRHAKIKRAITFIMVVAIVFVICFLPSVVVRIHIFWLLHTSGTQNCEVYRSVDLAFFITLSFTYMNSMLDPVVYYFSSPSFPNFFSTLINRCLQRKITGEPDNNRSTSVELTGDPNKTRGAPEALIANSGEPWSPSYLGPTSNNHSKKGHCHQEPASLEKQLGCCIE
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp452411HCAR3hydroxycarboxylic acid receptor 39598VGNC:13105OMA, EggNOG
Mouse80885Hcar2hydroxycarboxylic acid receptor 210090MGI:1933383Inparanoid, OMA, EggNOG
Rat353250Hcar2hydroxycarboxylic acid receptor 210116RGD:727952Inparanoid, OMA, EggNOG
Opossum100022273LOC100022273hydroxycarboxylic acid receptor 213616Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Hydroxycarboxylic acid receptor    /    Hydroxycarboxylic acid receptor 3

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpezifikationenSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Dürfen wir Sie über Rabattaktionen informieren?

      Später erinnern

      Vielen Dank! Bitte überprüfen Sie Ihren E-Mail-Posteingang, um zu bestätigen.

      Hoppla! Benachrichtigungen sind deaktiviert.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.