🌎 Ship to: United States
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | BTB/POZ domain-containing protein KCTD8 |
|---|
Gene and Protein Information
| Gene ID | 386617 |
|---|---|
| Uniprot Accession IDs | Q6ZWB6 A2RU39 |
| Ensembl ID | ENSP00000353129 |
| Sequence | MALKDTGSGGSTILPISEMVSSSSSPGASAAAAPGPCAPSPFPEVVELNVGGQVYVTKHSTLLSVPDSTLASMFSPSSPRGGARRRGELPRDSRARFFIDRDGFLFRYVLDYLRDKQLALPEHFPEKERLLREAEYFQLTDLVKLLSPKVTKQNSLNDEGCQSDLEDNVSQGSSDALLLRGAAAAVPSGPGAHGGGGGGGAQDKRSGFLTLGYRGSYTTVRDNQADAKFRRVARIMVCGRIALAKEVFGDTLNESRDPDRQPEKYTSRFYLKFTYLEQAFDRLSEAGFHMVACNSSGTAAFVNQYRDDKIWSSYTEYIFFRPPQKIVSPKQEHEDRKHDKVTDKGSESGTSCNELSTSSCDSHSEASTPQDNPSSAQQATAHQPNTLTLDRPSKKAPVQWIPPPDKRRNSELFQTLISKSRETNLSKKKVCEKLSVEEEMKKCIQDFKKIHIPDYFPERKRQWQSELLQKYGL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 461195 | KCTD8 | potassium channel tetramerization domain containing 8 | 9598 | VGNC:13099 | OMA, EggNOG |
| Macaque | 703107 | KCTD8 | potassium channel tetramerization domain containing 8 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 243043 | Kctd8 | potassium channel tetramerisation domain containing 8 | 10090 | MGI:2443804 | Inparanoid, OMA, EggNOG |
| Dog | 610705 | KCTD8 | potassium channel tetramerization domain containing 8 | 9615 | VGNC:42311 | Inparanoid, OMA |
| Opossum | KCTD8 | potassium channel tetramerization domain containing 8 [Source:HGNC Symbol;Acc:HGNC:22394] | 13616 | Inparanoid, OMA | ||
| Chicken | 770600 | KCTD8 | potassium channel tetramerization domain containing 8 | 9031 | CGNC:10600 | Inparanoid, OMA |
| Anole lizard | 100562362 | kctd8 | potassium channel tetramerization domain containing 8 | 28377 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.