🌎 Versand an: United States
Navigation umschalten
Warenkorb
Suche
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Struktur Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

HDAC3

BeschreibungHistone deacetylase 3

Gene and Protein Information

Gene ID8841
Uniprot Accession IDs O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 HD3
Ensembl ID ENSP00000302967
Symbol HD3 RPD3 KDAC3 RPD3-2
FamilyBelongs to the histone deacetylase family. HD type 1 subfamily.
Sequence
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp738624HDAC3histone deacetylase 39598VGNC:4032OMA, EggNOG
Macaque704467HDAC3histone deacetylase 39544Inparanoid, OMA, EggNOG
Mouse15183Hdac3histone deacetylase 310090MGI:1343091Inparanoid, OMA, EggNOG
Rat84578Hdac3histone deacetylase 310116RGD:619977Inparanoid, OMA
Dog478040HDAC3histone deacetylase 39615VGNC:50628Inparanoid, OMA, EggNOG
Horse100061405HDAC3histone deacetylase 39796VGNC:49121Inparanoid, OMA, EggNOG
Pig100511372HDAC3histone deacetylase 39823Inparanoid, OMA, EggNOG
Opossum100022921HDAC3histone deacetylase 313616Inparanoid, EggNOG
Chicken395506HDAC3histone deacetylase 39031CGNC:1896Inparanoid, OMA, EggNOG
Anole lizard100557493hdac3histone deacetylase 328377Inparanoid, OMA, EggNOG
Xenopus549637hdac3histone deacetylase 38364XB-GENE-481106Inparanoid, OMA, EggNOG
Zebrafish393965hdac3histone deacetylase 37955ZDB-GENE-040426-847Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    reductase    /    Histone deacetylase 3
protein    /    hydrolase    /    deacetylase    /    Histone deacetylase 3
protein    /    hydrolase    /    nucleic acid binding    /    Histone deacetylase 3
DTO Classes
protein    /    Epigenetic regulator    /    Eraser    /    Histone deacetylase    /    HDAC class I    /    Histone deacetylase 3

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpezifikationenSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Dürfen wir Sie über Rabattaktionen informieren?

      Später erinnern

      Vielen Dank! Bitte überprüfen Sie Ihren E-Mail-Posteingang, um zu bestätigen.

      Hoppla! Benachrichtigungen sind deaktiviert.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.