Toggle Nav 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Golgi phosphoprotein 3 |
|---|
Gene and Protein Information
| Gene ID | 64083 |
|---|---|
| Uniprot Accession IDs | Q9H4A6 Q9UIW5 |
| Ensembl ID | ENSP00000265070 |
| Symbol | GPP34 GOPP1 GPP34 MIDAS Vps74 |
| Family | Belongs to the GOLPH3/VPS74 family. |
| Sequence | MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 461946 | GOLPH3 | golgi phosphoprotein 3 | 9598 | VGNC:6929 | OMA, EggNOG |
| Macaque | 700428 | GOLPH3 | golgi phosphoprotein 3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 66629 | Golph3 | golgi phosphoprotein 3 | 10090 | MGI:1913879 | Inparanoid, OMA, EggNOG |
| Rat | 78961 | Golph3 | golgi phosphoprotein 3 | 10116 | RGD:621226 | Inparanoid, OMA, EggNOG |
| Dog | 489241 | GOLPH3 | golgi phosphoprotein 3 | 9615 | VGNC:49691 | Inparanoid, OMA, EggNOG |
| Horse | 100068637 | GOLPH3 | golgi phosphoprotein 3 | 9796 | VGNC:18458 | Inparanoid, OMA, EggNOG |
| Cow | 531359 | GOLPH3 | golgi phosphoprotein 3 | 9913 | VGNC:29492 | Inparanoid, OMA, EggNOG |
| Opossum | 100015793 | GOLPH3 | golgi phosphoprotein 3 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 427422 | GOLPH3 | golgi phosphoprotein 3 | 9031 | CGNC:53081 | Inparanoid, OMA |
| Anole lizard | 100559943 | golph3 | golgi phosphoprotein 3 | 28377 | Inparanoid, OMA | |
| Zebrafish | 561662 | si:dkey-27b3.2 | si:dkey-27b3.2 | 7955 | ZDB-GENE-091117-10 | Inparanoid, OMA |
| S.cerevisiae | 851978 | VPS74 | Vps74p | 4932 | S000002780 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.