🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

GNMT

BeschreibungGlycine N-methyltransferase

Gene and Protein Information

Gene ID27232
Uniprot Accession IDs Q14749 Q5T8W2 Q9NNZ1 Q9NS24
Ensembl ID ENSP00000361894
Symbol HEL-S-182mP
FamilyBelongs to the class I-like SAM-binding methyltransferase superfamily. Glycine N-methyltransferase family.
Sequence
MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp462703GNMTglycine N-methyltransferase9598VGNC:2847OMA, EggNOG
Macaque697722GNMTglycine N-methyltransferase9544Inparanoid, OMA, EggNOG
Mouse14711Gnmtglycine N-methyltransferase10090MGI:1202304Inparanoid, OMA, EggNOG
Rat25134Gnmtglycine N-methyltransferase10116RGD:2719OMA, EggNOG
Rat100911564LOC100911564glycine N-methyltransferase-like10116RGD:6491825Inparanoid, OMA
Dog474905GNMTglycine N-methyltransferase9615VGNC:41329Inparanoid, OMA, EggNOG
Horse100067145GNMTglycine N-methyltransferase9796VGNC:18442Inparanoid, OMA, EggNOG
Cow538212GNMTglycine N-methyltransferase9913VGNC:29475Inparanoid, OMA, EggNOG
Opossum100010632GNMTglycine N-methyltransferase13616Inparanoid, OMA, EggNOG
Anole lizard100552842gnmtglycine N-methyltransferase28377Inparanoid, OMA, EggNOG
Zebrafish403338gnmtglycine N-methyltransferase7955ZDB-GENE-040227-1Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.