Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Formimidoyltransferase-cyclodeaminase |
|---|
Gene and Protein Information
| Gene ID | 10841 |
|---|---|
| Uniprot Accession IDs | O95954 B9EGD0 Q86V03 Q9HCT4 Q9HCT5 Q9HCT6 Q9UHJ2 |
| Ensembl ID | ENSP00000291670 |
| Symbol | LCHC1 |
| Family | In the N-terminal section; belongs to the formiminotransferase family. |
| Sequence | MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 721818 | FTCD | formimidoyltransferase cyclodeaminase | 9544 | OMA, EggNOG | |
| Mouse | 14317 | Ftcd | formiminotransferase cyclodeaminase | 10090 | MGI:1339962 | Inparanoid, OMA, EggNOG |
| Rat | 89833 | Ftcd | formimidoyltransferase cyclodeaminase | 10116 | RGD:70915 | Inparanoid, OMA, EggNOG |
| Dog | 607685 | FTCD | formimidoyltransferase cyclodeaminase | 9615 | VGNC:41002 | Inparanoid, OMA, EggNOG |
| Horse | 100049972 | FTCD | formimidoyltransferase cyclodeaminase | 9796 | VGNC:18148 | Inparanoid, OMA, EggNOG |
| Cow | 535816 | FTCD | formimidoyltransferase cyclodeaminase | 9913 | VGNC:29137 | Inparanoid, OMA, EggNOG |
| Pig | 397517 | FTCD | formimidoyltransferase cyclodeaminase | 9823 | Inparanoid, OMA, EggNOG | |
| Chicken | 395726 | FTCD | formimidoyltransferase cyclodeaminase | 9031 | CGNC:4601 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100558718 | ftcd | formimidoyltransferase cyclodeaminase | 28377 | OMA, EggNOG | |
| Xenopus | 448617 | ftcd | formimidoyltransferase cyclodeaminase | 8364 | XB-GENE-963745 | Inparanoid, OMA, EggNOG |
| Zebrafish | 394052 | ftcd | formimidoyltransferase cyclodeaminase | 7955 | ZDB-GENE-030131-9643 | Inparanoid, OMA, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.