🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Insulin-like growth factor-binding protein 1 |
|---|
Gene and Protein Information
| Gene ID | 3484 |
|---|---|
| Uniprot Accession IDs | P08833 A4D2F4 D3DVL9 Q8IYP5 IBP-1 |
| Ensembl ID | ENSP00000275525 |
| Symbol | IBP1 AFBP IBP1 PP12 IGF-BP25 hIGFBP-1 |
| Sequence | MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 463395 | IGFBP1 | insulin like growth factor binding protein 1 | 9598 | VGNC:4397 | OMA, EggNOG |
| Macaque | 696994 | IGFBP1 | insulin like growth factor binding protein 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 16006 | Igfbp1 | insulin-like growth factor binding protein 1 | 10090 | MGI:96436 | Inparanoid, OMA, EggNOG |
| Rat | 25685 | Igfbp1 | insulin-like growth factor binding protein 1 | 10116 | RGD:2872 | Inparanoid, OMA |
| Dog | 480812 | IGFBP1 | insulin like growth factor binding protein 1 | 9615 | VGNC:41902 | Inparanoid, OMA, EggNOG |
| Horse | 100034154 | IGFBP1 | insulin like growth factor binding protein 1 | 9796 | VGNC:18973 | Inparanoid, OMA, EggNOG |
| Cow | 282259 | IGFBP1 | insulin like growth factor binding protein 1 | 9913 | VGNC:30083 | Inparanoid, OMA, EggNOG |
| Pig | 397270 | IGFBP1 | insulin like growth factor binding protein 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100030454 | IGFBP1 | insulin like growth factor binding protein 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100076308 | IGFBP1 | insulin like growth factor binding protein 1 | 9258 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100564199 | igfbp1 | insulin like growth factor binding protein 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 619366 | igfbp1 | insulin like growth factor binding protein 1 | 8364 | XB-GENE-485497 | Inparanoid, OMA, EggNOG |
| Zebrafish | 793907 | igfbp1b | insulin-like growth factor binding protein 1b | 7955 | ZDB-GENE-081210-3 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.