🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

IGFBP6

BeschreibungInsulin-like growth factor-binding protein 6

Gene and Protein Information

Gene ID3489
Uniprot Accession IDs P24592 Q14492 IBP-6
Ensembl ID ENSP00000301464
Symbol IBP6 IBP6
Sequence
MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp451929IGFBP6insulin like growth factor binding protein 69598VGNC:5428OMA, EggNOG
Mouse16012Igfbp6insulin-like growth factor binding protein 610090MGI:96441Inparanoid, OMA, EggNOG
Rat25641Igfbp6insulin-like growth factor binding protein 610116RGD:2877Inparanoid, OMA, EggNOG
Dog607374IGFBP6insulin like growth factor binding protein 69615VGNC:41907Inparanoid, OMA, EggNOG
Horse100034156IGFBP6insulin like growth factor binding protein 69796VGNC:18975Inparanoid, OMA, EggNOG
Cow404186IGFBP6insulin like growth factor binding protein 69913VGNC:30088Inparanoid, OMA, EggNOG
Pig100101923IGFBP6insulin like growth factor binding protein 69823Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.