Toggle Nav 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Bifunctional purine biosynthesis protein PURH |
|---|
Gene and Protein Information
| Gene ID | 471 |
|---|---|
| Uniprot Accession IDs | P31939 A8K202 E9PBU3 Q13856 Q53S28 |
| Ensembl ID | ENSP00000236959 |
| Symbol | PURH PURH AICAR AICARFT IMPCHASE HEL-S-70p |
| Family | Belongs to the PurH family. |
| Sequence | MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 459925 | ATIC | 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase | 9598 | VGNC:101 | OMA, EggNOG |
| Macaque | 694819 | ATIC | 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 108147 | Atic | 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase | 10090 | MGI:1351352 | Inparanoid, OMA, EggNOG |
| Rat | 81643 | Atic | 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase | 10116 | RGD:70879 | Inparanoid, OMA, EggNOG |
| Dog | 488513 | ATIC | 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase | 9615 | VGNC:38229 | Inparanoid, OMA, EggNOG |
| Horse | 100054298 | ATIC | 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase | 9796 | VGNC:15630 | Inparanoid, OMA, EggNOG |
| Cow | 506343 | ATIC | 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase | 9913 | VGNC:26264 | Inparanoid, OMA, EggNOG |
| Pig | 100170854 | ATIC | 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100012538 | ATIC | 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100089876 | LOC100089876 | bifunctional purine biosynthesis protein PURH-like | 9258 | Inparanoid, EggNOG | |
| Chicken | 396091 | ATIC | 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase | 9031 | CGNC:2606 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100559178 | atic | 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase | 28377 | OMA, EggNOG | |
| Xenopus | 448061 | atic | 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase | 8364 | XB-GENE-998807 | Inparanoid, OMA, EggNOG |
| Zebrafish | 140622 | atic | 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase | 7955 | ZDB-GENE-011212-4 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 850715 | ADE16 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase ADE16 | 4932 | S000004018 | Inparanoid, OMA |
| S.cerevisiae | 855149 | ADE17 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase ADE17 | 4932 | S000004727 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / transferase / methyltransferase / Bifunctional purine biosynthesis protein PURH
protein / transferase / hydrolase / Bifunctional purine biosynthesis protein PURH
protein / transferase / methyltransferase / Bifunctional purine biosynthesis protein PURH
protein / transferase / hydrolase / Bifunctional purine biosynthesis protein PURH
DTO Classes
protein / Enzyme / Transferase / Methyltransferase / Bifunctional purine biosynthesis protein PURH
protein / Enzyme / Transferase / Methyltransferase / Bifunctional purine biosynthesis protein PURH
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.