P2RY12

BeschreibungP2Y purinoceptor 12

Gene and Protein Information

Gene ID64805
Uniprot Accession IDs Q9H244 D3DNJ5 Q546J7 P2Y12
Ensembl ID ENSP00000307259
Symbol HORK3 HORK3 P2Y12 ADPG-R BDPLT8 SP1999 P2T(AC) P2Y(AC) P2Y(12)R P2Y(ADP) P2Y(cyc)
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Macaque710036P2RY12purinergic receptor P2Y129544Inparanoid, OMA, EggNOG
Mouse70839P2ry12purinergic receptor P2Y, G-protein coupled 1210090MGI:1918089Inparanoid, OMA, EggNOG
Rat64803P2ry12purinergic receptor P2Y1210116RGD:621681Inparanoid, OMA, EggNOG
Dog442958P2RY12purinergic receptor P2Y129615VGNC:44214Inparanoid, OMA, EggNOG
Horse100630046P2RY12purinergic receptor P2Y129796VGNC:21110Inparanoid, OMA, EggNOG
Cow408007P2RY12purinergic receptor P2Y129913VGNC:32525Inparanoid, OMA, EggNOG
Pig503659P2RY12purinergic receptor P2Y129823OMA, EggNOG
Opossum100618708P2RY12purinergic receptor P2Y1213616Inparanoid, OMA, EggNOG
Platypus100682030P2RY12purinergic receptor P2Y129258Inparanoid, OMA, EggNOG
Anole lizard103278184p2ry12purinergic receptor P2Y1228377Inparanoid, OMA
Xenopus100493410p2ry12purinergic receptor P2Y, G-protein coupled, 128364XB-GENE-947453Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    P2y purinoceptor 12
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Purinoceptor    /    P2Y receptor    /    P2y purinoceptor 12

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.