🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

DAZAP1

BeschreibungDAZ-associated protein 1

Gene and Protein Information

Gene ID26528
Uniprot Accession IDs Q96EP5 Q96MJ3 Q9NRR9
Ensembl ID ENSP00000233078
Sequence
MNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp455549DAZAP1DAZ associated protein 19598VGNC:10983OMA, EggNOG
Macaque707132DAZAP1DAZ associated protein 19544Inparanoid, OMA, EggNOG
Mouse70248Dazap1DAZ associated protein 110090MGI:1917498Inparanoid, OMA, EggNOG
Rat362836Dazap1DAZ associated protein 110116RGD:1305280Inparanoid, OMA, EggNOG
Dog100683271DAZAP1DAZ associated protein 19615VGNC:39778Inparanoid, OMA, EggNOG
HorseDAZAP1DAZ associated protein 1 [Source:HGNC Symbol;Acc:HGNC:2683]9796OMA, EggNOG
Cow614783DAZAP1DAZ associated protein 19913VGNC:27885Inparanoid, OMA, EggNOG
Pig100625005DAZAP1DAZ associated protein 19823Inparanoid, OMA, EggNOG
Opossum100020847DAZAP1DAZ associated protein 113616Inparanoid, OMA, EggNOG
Platypus100076674DAZAP1DAZ associated protein 19258Inparanoid, OMA, EggNOG
Chicken427266DAZAP1DAZ associated protein 19031CGNC:11311Inparanoid, OMA, EggNOG
Xenopus448406dazap1DAZ associated protein 18364XB-GENE-856469Inparanoid, OMA, EggNOG
Zebrafish561459dazap1DAZ associated protein 17955ZDB-GENE-070212-1Inparanoid, OMA
Fruitfly33968Hrb27CHeterogeneous nuclear ribonucleoprotein at 27C7227FBgn0004838Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.