Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Cyclin-dependent kinase inhibitor 3 |
|---|
Gene and Protein Information
| Gene ID | 1033 |
|---|---|
| Uniprot Accession IDs | Q16667 Q53ZU6 Q5U0M4 Q6P1N8 Q99585 Q9BPW7 Q9BY36 Q9C042 Q9C046 Q9C047 Q9C049 Q9C051 Q9C053 |
| Ensembl ID | ENSP00000335357 |
| Symbol | CDI1 CIP2 KAP KAP CDI1 CIP2 KAP1 |
| Family | Belongs to the protein-tyrosine phosphatase family. |
| Sequence | MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 453242 | CDKN3 | cyclin dependent kinase inhibitor 3 | 9598 | VGNC:7641 | OMA, EggNOG |
| Macaque | 694877 | CDKN3 | cyclin dependent kinase inhibitor 3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 72391 | Cdkn3 | cyclin-dependent kinase inhibitor 3 | 10090 | MGI:1919641 | Inparanoid, OMA, EggNOG |
| Rat | 289993 | Cdkn3 | cyclin-dependent kinase inhibitor 3 | 10116 | RGD:1307781 | Inparanoid, OMA, EggNOG |
| Dog | 100856636 | CDKN3 | cyclin dependent kinase inhibitor 3 | 9615 | VGNC:39073 | Inparanoid, OMA, EggNOG |
| Horse | 100056254 | CDKN3 | cyclin dependent kinase inhibitor 3 | 9796 | VGNC:16368 | Inparanoid, OMA, EggNOG |
| Cow | 615282 | CDKN3 | cyclin dependent kinase inhibitor 3 | 9913 | VGNC:27148 | Inparanoid, OMA, EggNOG |
| Pig | 397589 | CDKN3 | cyclin dependent kinase inhibitor 3 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100029059 | CDKN3 | cyclin dependent kinase inhibitor 3 | 13616 | Inparanoid, EggNOG | |
| Platypus | CDKN3 | cyclin dependent kinase inhibitor 3 [Source:HGNC Symbol;Acc:HGNC:1791] | 9258 | OMA, EggNOG | ||
| Chicken | 423562 | CDKN3 | cyclin dependent kinase inhibitor 3 | 9031 | CGNC:9281 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100567553 | cdkn3 | cyclin dependent kinase inhibitor 3 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 402796 | cdkn3 | cyclin-dependent kinase inhibitor 3 | 7955 | ZDB-GENE-060427-2 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.