🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

OXGR1

Beschreibung2-oxoglutarate receptor 1

Gene and Protein Information

Gene ID27199
Uniprot Accession IDs Q96P68 Q5T5A7 Q86TL1
Ensembl ID ENSP00000298440
Symbol GPR80 GPR99 P2RY15 P2Y15 aKGR GPR80 GPR99 P2Y15 P2RY15
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MNEPLDYLANASDFPDYAAAFGNCTDENIPLKMHYLPVIYGIIFLVGFPGNAVVISTYIFKMRPWKSSTIIMLNLACTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFSFHFNLYSSILFLTCFSIFRYCVIIHPMSCFSIHKTRCAVVACAVVWIISLVAVIPMTFLITSTNRTNRSACLDLTSSDELNTIKWYNLILTATTFCLPLVIVTLCYTTIIHTLTHGLQTDSCLKQKARRLTILLLLAFYVCFLPFHILRVIRIESRLLSISCSIENQIHEAYIVSRPLAALNTFGNLLLYVVVSDNFQQAVCSTVRCKVSGNLEQAKKISYSNNP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Macaque696735OXGR1oxoglutarate receptor 19544Inparanoid, OMA, EggNOG
Mouse239283Oxgr1oxoglutarate (alpha-ketoglutarate) receptor 110090MGI:2685145Inparanoid, OMA, EggNOG
Rat290493Oxgr1oxoglutarate receptor 110116RGD:1303155Inparanoid, OMA, EggNOG
DogOXGR1oxoglutarate receptor 1 [Source:HGNC Symbol;Acc:HGNC:4531]9615OMA, EggNOG
Horse100060024OXGR1oxoglutarate receptor 19796VGNC:21100Inparanoid, OMA, EggNOG
Cow539318OXGR1oxoglutarate receptor 19913VGNC:32510Inparanoid, OMA, EggNOG
Pig100626102OXGR1oxoglutarate receptor 19823OMA, EggNOG
Opossum100026790OXGR1oxoglutarate receptor 113616Inparanoid, OMA, EggNOG
Chicken428023OXGR1oxoglutarate receptor 19031CGNC:53243Inparanoid, OMA
Zebrafishoxgr1boxoglutarate (alpha-ketoglutarate) receptor 1b7955ZDB-GENE-070912-324Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    2-oxoglutarate receptor 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.