🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS CoA Structure
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

P2RY13

BeschreibungP2Y purinoceptor 13

Gene and Protein Information

Gene ID53829
Uniprot Accession IDs Q9BPV8 B2R827 Q05C50 Q6DKN4 Q8IUT5 Q8TDU7 Q9BY61 P2Y13
Ensembl ID ENSP00000320376
Symbol GPR86 GPR94 GPCR1 GPR86 GPR94 P2Y13 SP174 FKSG77
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MTAAIRRQRELSILPKVTLEAMNTTVMQGFNRSERCPRDTRIVQLVFPALYTVVFLTGILLNTLALWVFVHIPSSSTFIIYLKNTLVADLIMTLMLPFKILSDSHLAPWQLRAFVCRFSSVIFYETMYVGIVLLGLIAFDRFLKIIRPLRNIFLKKPVFAKTVSIFIWFFLFFISLPNTILSNKEATPSSVKKCASLKGPLGLKWHQMVNNICQFIFWTVFILMLVFYVVIAKKVYDSYRKSKSKDRKNNKKLEGKVFVVVAVFFVCFAPFHFARVPYTHSQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLCKKFTEKLPCMQGRKTTASSQENHSSQTDNITLG
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp738859P2RY13purinergic receptor P2Y139598VGNC:7992OMA, EggNOG
Mouse74191P2ry13purinergic receptor P2Y, G-protein coupled 1310090MGI:1921441Inparanoid, OMA, EggNOG
Rat310444P2ry13purinergic receptor P2Y1310116RGD:1302941Inparanoid, OMA, EggNOG
Dog102155830P2RY13purinergic receptor P2Y139615VGNC:44215Inparanoid, OMA, EggNOG
Horse100050217P2RY13purinergic receptor P2Y139796VGNC:21111Inparanoid, OMA, EggNOG
Cow782774P2RY13purinergic receptor P2Y139913VGNC:32526Inparanoid, OMA, EggNOG
Opossum103104547P2RY13purinergic receptor P2Y1313616Inparanoid, OMA, EggNOG
Anole lizard103278183p2ry13purinergic receptor P2Y1328377Inparanoid, OMA
Xenopus548413p2ry13purinergic receptor P2Y, G-protein coupled, 138364XB-GENE-5807786Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    P2Y purinoceptor 13
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Purinoceptor    /    P2Y receptor    /    P2Y purinoceptor 13

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.