🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit |
|---|
Gene and Protein Information
| Gene ID | 5501 |
|---|---|
| Uniprot Accession IDs | P36873 PP-1G |
| Ensembl ID | ENSP00000341779 |
| Symbol | PP1C PP-1G PPP1G |
| Family | Belongs to the PPP phosphatase family. PP-1 subfamily. |
| Sequence | MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 709935 | PPP1CC | protein phosphatase 1 catalytic subunit gamma | 9544 | Inparanoid, OMA | |
| Mouse | 19047 | Ppp1cc | protein phosphatase 1, catalytic subunit, gamma isoform | 10090 | MGI:104872 | Inparanoid, OMA, EggNOG |
| Rat | 24669 | Ppp1cc | protein phosphatase 1 catalytic subunit gamma | 10116 | RGD:3377 | Inparanoid, OMA, EggNOG |
| Dog | 403557 | PPP1CC | protein phosphatase 1 catalytic subunit gamma | 9615 | VGNC:52957 | Inparanoid, OMA, EggNOG |
| Horse | 100058160 | PPP1CC | protein phosphatase 1 catalytic subunit gamma | 9796 | VGNC:50962 | Inparanoid, OMA |
| Cow | 282318 | PPP1CC | protein phosphatase 1 catalytic subunit gamma | 9913 | VGNC:53916 | Inparanoid, OMA, EggNOG |
| Opossum | 100019898 | PPP1CC | protein phosphatase 1 catalytic subunit gamma | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 416872 | PPP1CC | protein phosphatase 1 catalytic subunit gamma | 9031 | CGNC:50363 | OMA, EggNOG |
| Anole lizard | 100565990 | ppp1cc | protein phosphatase 1 catalytic subunit gamma | 28377 | Inparanoid, OMA | |
| Xenopus | 407879 | ppp1cc | protein phosphatase 1, catalytic subunit, gamma isozyme | 8364 | XB-GENE-967934 | Inparanoid, OMA, EggNOG |
| Zebrafish | 571753 | ppp1cc | protein phosphatase 1, catalytic subunit, gamma isozyme | 7955 | ZDB-GENE-030131-5877 | Inparanoid, OMA |
| Fruitfly | 49260 | Pp1-87B | Protein phosphatase 1 at 87B | 7227 | FBgn0004103 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.