🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Protein phosphatase 1 regulatory subunit 7 |
|---|
Gene and Protein Information
| Gene ID | 5510 |
|---|---|
| Uniprot Accession IDs | Q15435 B4DFD4 B5MCY6 Q9UQE5 Q9UQE6 Q9Y6K4 |
| Ensembl ID | ENSP00000234038 |
| Symbol | SDS22 SDS22 |
| Family | Belongs to the SDS22 family. |
| Sequence | MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPEEEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 460079 | PPP1R7 | protein phosphatase 1 regulatory subunit 7 | 9598 | VGNC:14345 | OMA, EggNOG |
| Macaque | 700574 | PPP1R7 | protein phosphatase 1 regulatory subunit 7 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 66385 | Ppp1r7 | protein phosphatase 1, regulatory (inhibitor) subunit 7 | 10090 | MGI:1913635 | Inparanoid, OMA, EggNOG |
| Dog | 100855698 | PPP1R7 | protein phosphatase 1 regulatory subunit 7 | 9615 | Inparanoid, OMA | |
| Horse | 100067637 | PPP1R7 | protein phosphatase 1 regulatory subunit 7 | 9796 | VGNC:52421 | Inparanoid, OMA, EggNOG |
| Cow | 505297 | PPP1R7 | protein phosphatase 1 regulatory subunit 7 | 9913 | VGNC:52808 | Inparanoid, OMA, EggNOG |
| Pig | 100511842 | PPP1R7 | protein phosphatase 1 regulatory subunit 7 | 9823 | Inparanoid, OMA, EggNOG | |
| Platypus | 100082676 | PPP1R7 | protein phosphatase 1 regulatory subunit 7 | 9258 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100552255 | ppp1r7 | protein phosphatase 1 regulatory subunit 7 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448394 | ppp1r7 | protein phosphatase 1 regulatory subunit 7 | 8364 | XB-GENE-964679 | Inparanoid, OMA, EggNOG |
| Zebrafish | 560323 | ppp1r7 | protein phosphatase 1, regulatory (inhibitor) subunit 7 | 7955 | ZDB-GENE-051113-288 | Inparanoid, OMA, EggNOG |
| C. elegans | 174266 | sds-22 | Protein phosphatase 1 regulatory subunit SDS22 homolog | 6239 | Inparanoid, OMA | |
| Fruitfly | 42091 | sds22 | CG5851 gene product from transcript CG5851-RA | 7227 | FBgn0028992 | Inparanoid, EggNOG |
| S.cerevisiae | 853641 | SDS22 | type 1 protein phosphatase-activating protein SDS22 | 4932 | S000001676 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.