🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

NPY5R

BeschreibungNeuropeptide Y receptor type 5

Gene and Protein Information

Gene ID4889
Uniprot Accession IDs Q15761 Q6GTR7 Q92916 NPY5-R
Ensembl ID ENSP00000423917
Symbol NPYR5 NPYR5 NPY5-R NPYY5-R
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp461582NPY5Rneuropeptide Y receptor Y59598VGNC:646Inparanoid, OMA, EggNOG
Macaque574150NPY5Rneuropeptide Y receptor Y59544Inparanoid, OMA, EggNOG
Mouse18168Npy5rneuropeptide Y receptor Y510090MGI:108082Inparanoid, OMA, EggNOG
Rat25340Npy5rneuropeptide Y receptor Y510116RGD:3199Inparanoid, OMA, EggNOG
Dog403712NPY5Rneuropeptide Y receptor Y59615VGNC:54273Inparanoid, OMA, EggNOG
HorseNPY5Rneuropeptide Y receptor Y5 [Source:HGNC Symbol;Acc:HGNC:7958]9796OMA, EggNOG
Cow781872NPY5Rneuropeptide Y receptor Y59913VGNC:32224Inparanoid, OMA, EggNOG
Pig100517770NPY5Rneuropeptide Y receptor Y59823Inparanoid, OMA, EggNOG
PlatypusNPY5Rneuropeptide Y receptor Y5 [Source:HGNC Symbol;Acc:HGNC:7958]9258OMA, EggNOG
Anole lizardNPY5Rneuropeptide Y receptor Y5 [Source:HGNC Symbol;Acc:HGNC:7958]28377Inparanoid, OMA, EggNOG
Xenopus779693npy5rneuropeptide Y receptor Y58364XB-GENE-960863Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Neuropeptide Y receptor    /    Neuropeptide y receptor type 5

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.