🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | LanC-like protein 2 |
|---|
Gene and Protein Information
| Gene ID | 55915 |
|---|---|
| Uniprot Accession IDs | Q9NS86 B2R8D4 Q6NSL4 Q8TCQ3 Q9BSR1 |
| Ensembl ID | ENSP00000254770 |
| Symbol | GPR69B TASP TASP GPR69B |
| Family | Belongs to the LanC-like protein family. |
| Sequence | MGETMSKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATTDEPGLPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFELDSSKRD Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 463936 | LANCL2 | LanC like 2 | 9598 | VGNC:7399 | OMA, EggNOG |
| Macaque | 704882 | LANCL2 | LanC like 2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 71835 | Lancl2 | LanC (bacterial lantibiotic synthetase component C)-like 2 | 10090 | MGI:1919085 | Inparanoid, OMA, EggNOG |
| Rat | 362375 | Lancl2 | LanC like 2 | 10116 | RGD:1310809 | Inparanoid, OMA, EggNOG |
| Dog | 483240 | LANCL2 | LanC like 2 | 9615 | VGNC:49916 | Inparanoid, OMA, EggNOG |
| Horse | 100067823 | LANCL2 | LanC like 2 | 9796 | VGNC:19579 | Inparanoid, OMA, EggNOG |
| Cow | 541142 | LANCL2 | LanC like 2 | 9913 | VGNC:30784 | Inparanoid, OMA, EggNOG |
| Pig | 100620078 | LANCL2 | LanC like 2 | 9823 | OMA, EggNOG | |
| Opossum | 100029611 | LANCL2 | LanC like 2 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | LANCL2 | LanC like 2 [Source:HGNC Symbol;Acc:HGNC:6509] | 9258 | OMA, EggNOG | ||
| Anole lizard | 100562031 | lancl2 | LanC like 2 | 28377 | Inparanoid, OMA | |
| Xenopus | 734145 | lancl2 | LanC like 2 | 8364 | XB-GENE-5744525 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.