Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | MOB kinase activator 1B |
|---|
Gene and Protein Information
| Gene ID | 92597 |
|---|---|
| Uniprot Accession IDs | Q7L9L4 B2R8U6 B4DRY3 Q8IY23 |
| Ensembl ID | ENSP00000379366 |
| Symbol | MOB4A MOBKL1A MATS2 MOB4A MOBKL1A |
| Family | Belongs to the MOB1/phocein family. |
| Sequence | MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 741698 | MOB1B | MOB kinase activator 1B | 9598 | VGNC:13028 | OMA, EggNOG |
| Macaque | 705155 | MOB1B | MOB kinase activator 1B | 9544 | OMA, EggNOG | |
| Mouse | 68473 | Mob1b | MOB kinase activator 1B | 10090 | MGI:1915723 | Inparanoid, OMA, EggNOG |
| Rat | 360920 | Mob1b | MOB kinase activator 1B | 10116 | RGD:1305114 | Inparanoid, OMA, EggNOG |
| Dog | 482187 | MOB1B | MOB kinase activator 1B | 9615 | VGNC:43300 | Inparanoid, OMA, EggNOG |
| Horse | 100054658 | MOB1B | MOB kinase activator 1B | 9796 | VGNC:20247 | Inparanoid, OMA |
| Cow | 515407 | MOB1B | MOB kinase activator 1B | 9913 | VGNC:31542 | Inparanoid, OMA |
| Opossum | MOB1B | MOB kinase activator 1B [Source:HGNC Symbol;Acc:HGNC:29801] | 13616 | OMA, EggNOG | ||
| Platypus | MOB1B | MOB kinase activator 1B [Source:HGNC Symbol;Acc:HGNC:29801] | 9258 | OMA, EggNOG | ||
| Chicken | 422647 | MOB1B | MOB kinase activator 1B | 9031 | CGNC:8797 | OMA, EggNOG |
| Anole lizard | 100559197 | mob1b | MOB kinase activator 1B | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 393169 | mob1ba | MOB kinase activator 1Ba | 7955 | ZDB-GENE-040426-919 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / Enzyme modulator / Kinase modulator / Kinase activator / MOB kinase activator 1B
protein / Enzyme modulator / Kinase modulator / Kinase activator / MOB kinase activator 1B
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.