🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

CDC25C

BeschreibungM-phase inducer phosphatase 3

Gene and Protein Information

Gene ID995
Uniprot Accession IDs P30307 D3DQB8 Q96PL3 Q9H168 Q9H2E8 Q9H2E9 Q9H2F1
Ensembl ID ENSP00000321656
Symbol CDC25 PPP1R60
FamilyBelongs to the MPI phosphatase family.
Sequence
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp746151CDC25Ccell division cycle 25C9598VGNC:3940OMA, EggNOG
Macaque714115CDC25Ccell division cycle 25C9544Inparanoid, OMA, EggNOG
Mouse12532Cdc25ccell division cycle 25C10090MGI:88350Inparanoid, OMA, EggNOG
Rat307511Cdc25ccell division cycle 25C10116RGD:1311875Inparanoid, OMA
Dog610456CDC25Ccell division cycle 25C9615VGNC:38991Inparanoid, OMA, EggNOG
Horse100062352CDC25Ccell division cycle 25C9796VGNC:16292Inparanoid, OMA, EggNOG
Cow507731CDC25Ccell division cycle 25C9913VGNC:27064Inparanoid, OMA, EggNOG
Pig100144474CDC25Ccell division cycle 25C9823Inparanoid, OMA, EggNOG
Opossum100025023CDC25Ccell division cycle 25C13616Inparanoid, EggNOG
Anole lizard100565034cdc25ccell division cycle 25C28377Inparanoid, OMA, EggNOG
Xenopus100124300cdc25ccell division cycle 25C8364XB-GENE-944821Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.