🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS CoA Structure
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

P2RX1

BeschreibungP2X purinoceptor 1

Gene and Protein Information

Gene ID5023
Uniprot Accession IDs P51575 Q9UK84 P2X1
Ensembl ID ENSP00000225538
Symbol P2X1 P2X1
FamilyBelongs to the P2X receptor family.
Sequence
MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSGLISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEHPEGGICKEDSGCTPGKAKRKAQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLREAENFTLFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENGTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKRHYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp454439P2RX1purinergic receptor P2X 19598VGNC:9500OMA, EggNOG
Macaque707658P2RX1purinergic receptor P2X 19544Inparanoid, OMA, EggNOG
Mouse18436P2rx1purinergic receptor P2X, ligand-gated ion channel, 110090MGI:1098235Inparanoid, OMA, EggNOG
Rat25505P2rx1purinergic receptor P2X 110116RGD:3240Inparanoid, OMA, EggNOG
Dog491223P2RX1purinergic receptor P2X 19615VGNC:44207Inparanoid, OMA, EggNOG
Horse100060689P2RX1purinergic receptor P2X 19796VGNC:21106Inparanoid, OMA, EggNOG
Cow514898P2RX1purinergic receptor P2X 19913VGNC:32517OMA, EggNOG
Pig106504105P2RX1purinergic receptor P2X 19823OMA, EggNOG
XenopusP2RX1purinergic receptor P2X 1 [Source:HGNC Symbol;Acc:HGNC:8533]8364OMA, EggNOG
Zebrafish387296p2rx1purinergic receptor P2X, ligand-gated ion channel, 17955ZDB-GENE-030319-1Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Ion channel    /    ATP-gated p2x receptor cation channel (p2x receptor) family    /    P2X purinoceptor 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.