Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Homeobox protein Nkx-2.6 |
|---|
Gene and Protein Information
| Gene ID | 137814 |
|---|---|
| Uniprot Accession IDs | A6NCS4 |
| Ensembl ID | ENSP00000320089 |
| Symbol | NKX2F CSX2 CTHM NKX2F NKX4-2 |
| Family | Belongs to the NK-2 homeobox family. |
| Sequence | MLLSPVTSTPFSVKDILRLERERSCPAASPHPRVRKSPENFQYLRMDAEPRGSEVHNAGGGGGDRKLDGSEPPGGPCEAVLEMDAERMGEPQPGLNAASPLGGGTRVPERGVGNSGDSVRGGRSEQPKARQRRKPRVLFSQAQVLALERRFKQQRYLSAPEREHLASALQLTSTQVKIWFQNRRYKCKRQRQDKSLELAGHPLTPRRVAVPVLVRDGKPCLGPGPGAPAFPSPYSAAVSPYSCYGGYSGAPYGAGYGTCYAGAPSGPAPHTPLASAGFGHGGQNATPQGHLAATLQGVRAW Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 464060 | NKX2-6 | NK2 homeobox 6 | 9598 | VGNC:834 | OMA, EggNOG |
| Macaque | 717445 | NKX2-6 | NK2 homeobox 6 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 18092 | Nkx2-6 | NK2 homeobox 6 | 10090 | MGI:97351 | Inparanoid, OMA, EggNOG |
| Rat | 364418 | Nkx2-6 | NK2 homeobox 6 | 10116 | RGD:1306149 | Inparanoid, OMA, EggNOG |
| Horse | 100146969 | NKX2-6 | NK2 homeobox 6 | 9796 | VGNC:20757 | Inparanoid, OMA, EggNOG |
| Cow | 527892 | NKX2-6 | NK2 homeobox 6 | 9913 | VGNC:32103 | OMA, EggNOG |
| Opossum | 100020870 | NKX2-6 | NK2 homeobox 6 | 13616 | Inparanoid, EggNOG | |
| Xenopus | 100038094 | nkx2-6 | NK2 homeobox 6 | 8364 | XB-GENE-486951 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Homeobox protein Nkx-2.6
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein Nkx-2.6
protein / nucleic acid binding / DNA binding protein / Homeobox protein Nkx-2.6
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein Nkx-2.6
DTO Classes
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein Nkx-2.6
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein Nkx-2.6
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.