🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D |
|---|
Gene and Protein Information
| Gene ID | 222236 |
|---|---|
| Uniprot Accession IDs | Q6IQ20 Q5CZ87 Q769K1 N-acyl phosphatidylethanolamine phospholipase D |
| Ensembl ID | ENSP00000407112 |
| Symbol | C7orf18 FMP30 C7orf18 NAPE-PLD |
| Family | Belongs to the NAPE-PLD family. |
| Sequence | MDENESNQSLMTSSQYPKEAVRKRQNSARNSGASDSSRFSRKSFKLDYRLEEDVTKSKKGKDGRFVNPWPTWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMDELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSVIALNERFGNELRWFVPLGLLDWMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLMDDNKVLWGSWSVLGPWNRFFFAGDTGYCPAFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDENF Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 472476 | NAPEPLD | N-acyl phosphatidylethanolamine phospholipase D | 9598 | VGNC:14052 | OMA, EggNOG |
| Macaque | 695318 | NAPEPLD | N-acyl phosphatidylethanolamine phospholipase D | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 242864 | Napepld | N-acyl phosphatidylethanolamine phospholipase D | 10090 | MGI:2140885 | Inparanoid, OMA, EggNOG |
| Rat | 296757 | Napepld | N-acyl phosphatidylethanolamine phospholipase D | 10116 | RGD:735197 | Inparanoid, OMA, EggNOG |
| Dog | 100685330 | NAPEPLD | N-acyl phosphatidylethanolamine phospholipase D | 9615 | VGNC:43621 | Inparanoid, OMA, EggNOG |
| Horse | 100050247 | NAPEPLD | N-acyl phosphatidylethanolamine phospholipase D | 9796 | VGNC:20561 | Inparanoid, OMA, EggNOG |
| Cow | 541291 | NAPEPLD | N-acyl phosphatidylethanolamine phospholipase D | 9913 | VGNC:31883 | Inparanoid, OMA, EggNOG |
| Pig | 100737731 | NAPEPLD | N-acyl phosphatidylethanolamine phospholipase D | 9823 | OMA, EggNOG | |
| Opossum | 100017822 | NAPEPLD | N-acyl phosphatidylethanolamine phospholipase D | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 417719 | NAPEPLD | N-acyl phosphatidylethanolamine phospholipase D | 9031 | CGNC:50575 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100559466 | napepld | N-acyl phosphatidylethanolamine phospholipase D | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100494898 | napepld | N-acyl phosphatidylethanolamine phospholipase D | 8364 | XB-GENE-962615 | Inparanoid, OMA, EggNOG |
| Zebrafish | 568061 | napepld | N-acyl phosphatidylethanolamine phospholipase D | 7955 | ZDB-GENE-030131-3856 | Inparanoid, OMA, EggNOG |
| C. elegans | 177136 | nape-2 | N-Acyl Phosphatidyl Ethanolamine specific phospholipase D (NAPE-PLD) homolog | 6239 | Inparanoid, OMA, EggNOG | |
| S.cerevisiae | 856001 | FMP30 | N-acetylphosphatidylethanolamine-hydrolyzing phospholipase D | 4932 | S000006024 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.