🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

NDUFA8

BeschreibungNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8

Gene and Protein Information

Gene ID4702
Uniprot Accession IDs P51970 B1AM93 Q9Y6N0
Ensembl ID ENSP00000362873
Symbol PGIV CI-19KD CI-PGIV
FamilyBelongs to the complex I NDUFA8 subunit family.
Sequence
MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp464897NDUFA8NADH:ubiquinone oxidoreductase subunit A89598VGNC:4799Inparanoid, OMA, EggNOG
Mouse68375Ndufa8NADH:ubiquinone oxidoreductase subunit A810090MGI:1915625Inparanoid, OMA, EggNOG
Rat296658Ndufa8NADH:ubiquinone oxidoreductase subunit A810116RGD:1306283Inparanoid, OMA
Dog480741NDUFA8NADH:ubiquinone oxidoreductase subunit A89615VGNC:43690Inparanoid, OMA, EggNOG
Horse100067562NDUFA8NADH:ubiquinone oxidoreductase subunit A89796VGNC:20627Inparanoid, OMA, EggNOG
Cow327710NDUFA8NADH:ubiquinone oxidoreductase subunit A89913VGNC:31951Inparanoid, OMA, EggNOG
Pig100154443NDUFA8NADH:ubiquinone oxidoreductase subunit A89823Inparanoid, OMA, EggNOG
Opossum100016535NDUFA8NADH:ubiquinone oxidoreductase subunit A813616Inparanoid, EggNOG
Platypus100081651NDUFA8NADH:ubiquinone oxidoreductase subunit A89258Inparanoid, OMA, EggNOG
Anole lizard100559966ndufa8NADH:ubiquinone oxidoreductase subunit A828377Inparanoid, OMA, EggNOG
Xenopus100125113ndufa8NADH:ubiquinone oxidoreductase subunit A88364XB-GENE-979564Inparanoid, OMA, EggNOG
Zebrafish393700ndufa8NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 87955ZDB-GENE-040426-1688Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    dehydrogenase    /    NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Dehydrogenase    /    NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.