🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

MKRN2

BeschreibungProbable E3 ubiquitin-protein ligase makorin-2

Gene and Protein Information

Gene ID23609
Uniprot Accession IDs Q9H000 A6NIA2 B3KRC5 B4DPR4 Q8N391 Q96BD4 Q9BUY2 Q9NRY1
Ensembl ID ENSP00000170447
Symbol RNF62 RNF62 HSPC070
Sequence
MSTKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCRYDHTRPSAAAGGAVGTMAHSVPSPAFHSPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQLCPYAAAGECRFGDACVYLHGEVCEICRLQVLHPFDPEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSICMEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIPSVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSEP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp460180MKRN2makorin ring finger protein 29598VGNC:2048OMA, EggNOG
Macaque697649MKRN2makorin ring finger protein 29544Inparanoid, OMA, EggNOG
Mouse67027Mkrn2makorin, ring finger protein, 210090MGI:1914277Inparanoid, OMA, EggNOG
Rat297525Mkrn2makorin, ring finger protein, 210116RGD:1310618Inparanoid, OMA, EggNOG
Dog476531MKRN2makorin ring finger protein 29615VGNC:43252Inparanoid, OMA, EggNOG
Horse100057038MKRN2makorin ring finger protein 29796VGNC:20205Inparanoid, OMA
Cow508004MKRN2makorin ring finger protein 29913Inparanoid, OMA
Pig100626891MKRN2makorin ring finger protein 29823Inparanoid, OMA
Opossum100025193MKRN2makorin ring finger protein 213616Inparanoid, OMA
Chicken374162MKRN2makorin ring finger protein 29031CGNC:3707Inparanoid, OMA, EggNOG
Anole lizard100557415mkrn2makorin ring finger protein 228377Inparanoid, OMA, EggNOG
Zebrafish170783mkrn2makorin, ring finger protein, 27955ZDB-GENE-020213-2Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    ligase    /    ubiquitin-protein ligase    /    Probable E3 ubiquitin-protein ligase makorin-2
DTO Classes
protein    /    Enzyme    /    Ligase    /    Ubiquitin-protein ligase    /    Probable E3 ubiquitin-protein ligase makorin-2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.