🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS CoA Structure
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

CA5A

BeschreibungCarbonic anhydrase 5A, mitochondrial

Gene and Protein Information

Gene ID763
Uniprot Accession IDs P35218 B2RPF2
Ensembl ID ENSP00000309649
Symbol CA5 CA5 CAV CAVA CA5AD GS1-21A4.1
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp468095CA5Acarbonic anhydrase 5A9598VGNC:9075OMA, EggNOG
Mouse12352Car5acarbonic anhydrase 5a, mitochondrial10090MGI:101946Inparanoid, OMA, EggNOG
Rat54233Car5acarbonic anhydrase 5A10116RGD:2243Inparanoid, OMA, EggNOG
Dog609174CA5Acarbonic anhydrase 5A9615VGNC:53312Inparanoid, OMA, EggNOG
Horse100070642CA5Acarbonic anhydrase 5A9796VGNC:49304Inparanoid, OMA, EggNOG
Cow515359CA5Acarbonic anhydrase 5A9913VGNC:50002Inparanoid, OMA, EggNOG
Opossum100025662CA5Acarbonic anhydrase 5A13616Inparanoid, EggNOG
PlatypusCA5Acarbonic anhydrase 5A [Source:HGNC Symbol;Acc:HGNC:1377]9258OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.