Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | G2/mitotic-specific cyclin-B1 |
|---|
Gene and Protein Information
| Gene ID | 891 |
|---|---|
| Uniprot Accession IDs | P14635 A8K066 Q5TZP9 |
| Ensembl ID | ENSP00000256442 |
| Symbol | CCNB CCNB |
| Family | Belongs to the cyclin family. Cyclin AB subfamily. |
| Sequence | MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 461835 | CCNB1 | cyclin B1 | 9598 | VGNC:3935 | OMA, EggNOG |
| Macaque | 699504 | CCNB1 | cyclin B1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 268697 | Ccnb1 | cyclin B1 | 10090 | MGI:88302 | Inparanoid, OMA, EggNOG |
| Rat | 25203 | Ccnb1 | cyclin B1 | 10116 | RGD:2291 | Inparanoid, OMA |
| Horse | 100050093 | CCNB1 | cyclin B1 | 9796 | VGNC:16204 | Inparanoid, OMA, EggNOG |
| Cow | 327679 | CCNB1 | cyclin B1 | 9913 | VGNC:26958 | Inparanoid, OMA, EggNOG |
| Pig | 397662 | CCNB1 | cyclin B1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100019387 | CCNB1 | cyclin B1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100083344 | CCNB1 | cyclin B1 | 9258 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100557278 | ccnb1 | cyclin B1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 394726 | ccnb1.2 | cyclin B1 | 8364 | XB-GENE-5736422 | Inparanoid, OMA |
| Zebrafish | 58025 | ccnb1 | cyclin B1 | 7955 | ZDB-GENE-000406-10 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / Enzyme modulator / Kinase modulator / Kinase activator / G2/mitotic-specific cyclin-B1
protein / Enzyme modulator / Kinase modulator / Kinase activator / G2/mitotic-specific cyclin-B1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.