🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

CCL21

BeschreibungC-C motif chemokine 21

Gene and Protein Information

Gene ID6366
Uniprot Accession IDs O00585 Q6ICR7
Ensembl ID ENSP00000259607
Symbol SCYA21 ECL SLC CKb9 TCA4 6Ckine SCYA21
FamilyBelongs to the intercrine beta (chemokine CC) family.
Sequence
MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp746205CCL21C-C motif chemokine ligand 219598VGNC:4651OMA, EggNOG
Mouse18829Ccl21achemokine (C-C motif) ligand 21A (serine)10090MGI:1349183Inparanoid, OMA
Mouse100862177Gm21541predicted gene, 2154110090MGI:5434896OMA, EggNOG
Rat298006Ccl21C-C motif chemokine ligand 2110116RGD:1311996Inparanoid, OMA, EggNOG
Horse100063059CCL21C-C motif chemokine ligand 219796OMA, EggNOG
Horse100060619LOC100060619C-C motif chemokine 21-like9796Inparanoid, OMA
Cow511112CCL21C-C motif chemokine ligand 219913VGNC:26948Inparanoid, OMA, EggNOG
Opossum100028728CCL21C-C motif chemokine ligand 2113616Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    chemokine    /    C-C motif chemokine 21
DTO Classes
protein    /    Signaling    /    Chemokine    /    C-C motif chemokine 21

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.