Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Cyclin-dependent kinase 9 |
|---|
Gene and Protein Information
| Gene ID | 1025 |
|---|---|
| Uniprot Accession IDs | P50750 Q5JU24 Q5JU25 Q5U006 Q96TF1 |
| Ensembl ID | ENSP00000362361 |
| Symbol | CDC2L4 TAK TAK C-2k CTK1 CDC2L4 PITALRE |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. |
| Sequence | MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 464755 | CDK9 | cyclin dependent kinase 9 | 9598 | VGNC:8807 | OMA, EggNOG |
| Mouse | 107951 | Cdk9 | cyclin-dependent kinase 9 (CDC2-related kinase) | 10090 | MGI:1328368 | Inparanoid, OMA, EggNOG |
| Rat | 362110 | Cdk9 | cyclin-dependent kinase 9 | 10116 | RGD:1359638 | Inparanoid, OMA |
| Dog | 100855805 | CDK9 | cyclin dependent kinase 9 | 9615 | VGNC:39062 | Inparanoid, OMA, EggNOG |
| Horse | 100070437 | CDK9 | cyclin dependent kinase 9 | 9796 | VGNC:16357 | Inparanoid, OMA, EggNOG |
| Cow | 520580 | CDK9 | cyclin dependent kinase 9 | 9913 | VGNC:27136 | Inparanoid, OMA, EggNOG |
| Pig | 100307051 | CDK9 | cyclin dependent kinase 9 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100010850 | CDK9 | cyclin dependent kinase 9 | 13616 | Inparanoid, EggNOG | |
| Xenopus | 448039 | cdk9 | cyclin-dependent kinase 9 | 8364 | XB-GENE-483721 | Inparanoid, OMA, EggNOG |
| Zebrafish | 321602 | cdk9 | cyclin-dependent kinase 9 (CDC2-related kinase) | 7955 | ZDB-GENE-030131-321 | Inparanoid, OMA, EggNOG |
| C. elegans | 173023 | cdk-9 | Probable cyclin-dependent kinase 9 | 6239 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.