🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

CAV2

BeschreibungCaveolin-2

Gene and Protein Information

Gene ID858
Uniprot Accession IDs P51636 A4D0U2 Q9UGM7
Ensembl ID ENSP00000222693
Symbol CAV
FamilyBelongs to the caveolin family.
Sequence
MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp736452CAV2caveolin 29598VGNC:4296Inparanoid, OMA, EggNOG
Macaque706980CAV2caveolin 29544Inparanoid, EggNOG
Mouse12390Cav2caveolin 210090MGI:107571Inparanoid, OMA, EggNOG
Rat363425Cav2caveolin 210116RGD:620348Inparanoid, OMA
Dog475294CAV2caveolin 29615VGNC:38752Inparanoid, OMA, EggNOG
Horse100071136CAV2caveolin 29796VGNC:16087Inparanoid, OMA, EggNOG
Cow493642CAV2caveolin 29913VGNC:26800Inparanoid, OMA, EggNOG
Pig100125375CAV2caveolin 29823Inparanoid, OMA, EggNOG
Anole lizard100560849cav2caveolin 228377Inparanoid, OMA, EggNOG
Xenopus548480cav2caveolin 28364XB-GENE-977295Inparanoid, OMA, EggNOG
Zebrafish415240cav2caveolin 27955ZDB-GENE-040625-164Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    G-protein modulator    /    Caveolin-2
protein    /    enzyme modulator    /    membrane traffic protein    /    Caveolin-2
protein    /    enzyme modulator    /    structural protein    /    Caveolin-2
protein    /    enzyme modulator    /    transmembrane receptor regulatory/adaptor protein    /    Caveolin-2
DTO Classes
protein    /    Enzyme modulator    /    G-protein modulator    /    Caveolin-2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.