🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

CCNB2

BeschreibungG2/mitotic-specific cyclin-B2

Gene and Protein Information

Gene ID9133
Uniprot Accession IDs O95067 B3KM93 Q6FI99
Ensembl ID ENSP00000288207
Symbol HsT17299
FamilyBelongs to the cyclin family. Cyclin AB subfamily.
Sequence
MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTKFIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp453478CCNB2cyclin B29598VGNC:3571OMA, EggNOG
Macaque702184CCNB2cyclin B29544OMA, EggNOG
Mouse12442Ccnb2cyclin B210090MGI:88311Inparanoid, OMA, EggNOG
Dog478324CCNB2cyclin B29615Inparanoid, OMA, EggNOG
Horse100054413CCNB2cyclin B29796VGNC:16206Inparanoid, OMA, EggNOG
Cow281668CCNB2cyclin B29913VGNC:26960Inparanoid, OMA, EggNOG
Pig100135668CCNB2cyclin B29823Inparanoid, OMA, EggNOG
Opossum100019727CCNB2cyclin B213616Inparanoid, EggNOG
Platypus100091100CCNB2cyclin B29258Inparanoid, OMA, EggNOG
Chicken415400CCNB2cyclin B29031CGNC:3052Inparanoid, OMA
Xenopus100270772ccnb2cyclin B28364XB-GENE-1005599Inparanoid, OMA
Zebrafish368316ccnb2cyclin B27955ZDB-GENE-030429-12Inparanoid, OMA
C. elegans177994cyb-2.1CYclin B6239Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    kinase activator    /    G2/mitotic-specific cyclin-B2
DTO Classes
protein    /    Enzyme modulator    /    Kinase modulator    /    Kinase activator    /    G2/mitotic-specific cyclin-B2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.