🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | C-C chemokine receptor type 7 |
|---|
Gene and Protein Information
| Gene ID | 1236 |
|---|---|
| Uniprot Accession IDs | P32248 C-C CKR-7 |
| Ensembl ID | ENSP00000246657 |
| Symbol | CMKBR7 EBI1 EVI1 BLR2 EBI1 CCR-7 CD197 CDw197 CMKBR7 CC-CKR-7 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 454654 | CCR7 | C-C motif chemokine receptor 7 | 9598 | VGNC:9171 | OMA, EggNOG |
| Macaque | 574231 | CCR7 | C-C motif chemokine receptor 7 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12775 | Ccr7 | chemokine (C-C motif) receptor 7 | 10090 | MGI:103011 | Inparanoid, OMA, EggNOG |
| Rat | 287673 | Ccr7 | C-C motif chemokine receptor 7 | 10116 | RGD:735151 | Inparanoid, OMA, EggNOG |
| Dog | 491011 | CCR7 | C-C motif chemokine receptor 7 | 9615 | VGNC:38915 | Inparanoid, OMA, EggNOG |
| Horse | 100067673 | CCR7 | C-C motif chemokine receptor 7 | 9796 | VGNC:16229 | Inparanoid, OMA, EggNOG |
| Cow | 510668 | CCR7 | C-C motif chemokine receptor 7 | 9913 | VGNC:26987 | Inparanoid, OMA, EggNOG |
| Pig | 396663 | CCR7 | C-C motif chemokine receptor 7 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100015808 | CCR7 | C-C motif chemokine receptor 7 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100551880 | ccr7 | C-C motif chemokine receptor 7 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100485139 | ccr7 | C-C motif chemokine receptor 7 | 8364 | XB-GENE-490572 | Inparanoid, OMA, EggNOG |
| Zebrafish | 565958 | ccr7 | chemokine (C-C motif) receptor 7 | 7955 | ZDB-GENE-060522-2 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Chemokine receptor / C-C chemokine receptor / C-c chemokine receptor type 7
protein / G-protein coupled receptor / Class A rhodopsin like / Chemokine receptor / C-C chemokine receptor / C-c chemokine receptor type 7
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.