CYP24A1

Beschreibung1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial

Gene and Protein Information

Gene ID1591
Uniprot Accession IDs Q07973 Q15807 Q32ML3 Q5I2W7 24-OHase
Ensembl ID ENSP00000216862
Symbol CYP24 CP24 HCAI CYP24 HCINF1 P450-CC24
FamilyBelongs to the cytochrome P450 family.
Sequence
MSSPISKSRSLAAFLQQLRSPRQPPRLVTSTAYTSPQPREVPVCPLTAGGETQNAAALPGPTSWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYRTESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELNKWSFESICLVLYEKRFGLLQKNAGDEAVNFIMAIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVLPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp746729CYP24A1cytochrome P450 family 24 subfamily A member 19598VGNC:9835OMA, EggNOG
Macaque698937LOC6989371,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial9544OMA, EggNOG
Mouse13081Cyp24a1cytochrome P450, family 24, subfamily a, polypeptide 110090MGI:88593Inparanoid, OMA, EggNOG
Rat25279Cyp24a1cytochrome P450, family 24, subfamily a, polypeptide 110116RGD:2462Inparanoid, OMA, EggNOG
Dog485935CYP24A1cytochrome P450 family 24 subfamily A member 19615VGNC:50338Inparanoid, OMA, EggNOG
Horse100053452CYP24A1cytochrome P450 family 24 subfamily A member 19796VGNC:50560Inparanoid, OMA, EggNOG
Cow540080CYP24A1cytochrome P450, family 24, subfamily A, polypeptide 19913Inparanoid, OMA, EggNOG
Pig397145CYP24A1cytochrome P450, family 24, subfamily A, polypeptide 19823Inparanoid, OMA, EggNOG
Anole lizard100564552LOC1005645521,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial28377OMA, EggNOG
Xenopus100497429cyp24a1cytochrome P450 family 24 subfamily A member 18364XB-GENE-479201Inparanoid, OMA, EggNOG
Zebrafish100004700cyp24a1cytochrome P450, family 24, subfamily A, polypeptide 17955ZDB-GENE-060825-1Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    oxygenase    /    1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Oxygenase    /    1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.