🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

CCL20

BeschreibungC-C motif chemokine 20

Gene and Protein Information

Gene ID6364
Uniprot Accession IDs P78556 Q53S51 Q99664
Ensembl ID ENSP00000351671
Symbol LARC MIP3A SCYA20 CKb4 LARC ST38 MIP3A Exodus MIP-3a SCYA20 MIP-3-alpha
FamilyBelongs to the intercrine beta (chemokine CC) family.
Sequence
MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp459991CCL20C-C motif chemokine ligand 209598VGNC:125OMA, EggNOG
Macaque574182CCL20C-C motif chemokine ligand 209544Inparanoid, OMA, EggNOG
Mouse20297Ccl20chemokine (C-C motif) ligand 2010090MGI:1329031Inparanoid, OMA, EggNOG
Rat29538Ccl20C-C motif chemokine ligand 2010116RGD:3646Inparanoid, OMA
Dog448790CCL20C-C motif chemokine ligand 209615VGNC:38884Inparanoid, OMA, EggNOG
Horse100629808CCL20C-C motif chemokine ligand 209796VGNC:16198Inparanoid, OMA, EggNOG
Cow281666CCL20C-C motif chemokine ligand 209913VGNC:26947Inparanoid, OMA, EggNOG
Pig553951CCL20C-C motif chemokine ligand 209823Inparanoid, OMA, EggNOG
Opossum100021210CCL20C-C motif chemokine ligand 2013616Inparanoid, OMA, EggNOG
Chicken395082CCL20C-C motif chemokine ligand 209031CGNC:2171OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    chemokine    /    C-C motif chemokine 20
DTO Classes
protein    /    Signaling    /    Chemokine    /    C-C motif chemokine 20

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.