🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | CD276 antigen |
|---|
Gene and Protein Information
| Gene ID | 80381 |
|---|---|
| Uniprot Accession IDs | Q5ZPR3 Q6P5Y4 Q6UXI2 Q8NBI8 Q8NC34 Q8NCB6 Q9BXR1 |
| Ensembl ID | ENSP00000320084 |
| Symbol | B7H3 B7H3 B7-H3 B7RP-2 4Ig-B7-H3 |
| Family | Belongs to the immunoglobulin superfamily. BTN/MOG family. |
| Sequence | MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 467818 | CD276 | CD276 molecule | 9598 | VGNC:3569 | OMA, EggNOG |
| Macaque | 699877 | CD276 | CD276 molecule | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 102657 | Cd276 | CD276 antigen | 10090 | MGI:2183926 | Inparanoid, EggNOG |
| Rat | 315716 | Cd276 | Cd276 molecule | 10116 | RGD:727815 | Inparanoid, EggNOG |
| Dog | 487638 | CD276 | CD276 molecule | 9615 | VGNC:38943 | Inparanoid, OMA, EggNOG |
| Horse | 100052046 | CD276 | CD276 molecule | 9796 | VGNC:50583 | Inparanoid, EggNOG |
| Cow | 508656 | CD276 | CD276 molecule | 9913 | VGNC:27020 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100560938 | cd276 | CD276 molecule | 28377 | Inparanoid, EggNOG | |
| Xenopus | 100101669 | cd276 | CD276 molecule | 8364 | XB-GENE-921537 | Inparanoid, EggNOG |
| Zebrafish | 791140 | cd276 | CD276 molecule | 7955 | ZDB-GENE-070112-452 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.