Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Cell division cycle protein 20 homolog |
|---|
Gene and Protein Information
| Gene ID | 991 |
|---|---|
| Uniprot Accession IDs | Q12834 B2R6Z6 D3DPJ1 Q5JUY4 Q9BW56 Q9UQI9 |
| Ensembl ID | ENSP00000361540 |
| Symbol | CDC20A p55CDC bA276H19.3 |
| Family | Belongs to the WD repeat CDC20/Fizzy family. |
| Sequence | MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 456819 | CDC20 | cell division cycle 20 | 9598 | VGNC:472 | OMA, EggNOG |
| Macaque | 702317 | CDC20 | cell division cycle 20 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 107995 | Cdc20 | cell division cycle 20 | 10090 | MGI:1859866 | Inparanoid, OMA, EggNOG |
| Rat | 64515 | Cdc20 | cell division cycle 20 | 10116 | RGD:620477 | Inparanoid, OMA, EggNOG |
| Dog | 100855774 | CDC20 | cell division cycle 20 | 9615 | VGNC:38987 | Inparanoid, OMA, EggNOG |
| Horse | 100053348 | CDC20 | cell division cycle 20 | 9796 | VGNC:16288 | Inparanoid, OMA, EggNOG |
| Cow | 515376 | CDC20 | cell division cycle 20 | 9913 | VGNC:27060 | Inparanoid, OMA, EggNOG |
| Pig | 397379 | CDC20 | cell division cycle 20 | 9823 | Inparanoid, OMA, EggNOG | |
| Platypus | CDC20 | cell division cycle 20 [Source:HGNC Symbol;Acc:HGNC:1723] | 9258 | OMA, EggNOG | ||
| Chicken | 424563 | CDC20 | cell division cycle 20 | 9031 | CGNC:7578 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100556314 | cdc20 | cell division cycle 20 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 394542 | cdc20 | cell division cycle 20 | 8364 | XB-GENE-970663 | Inparanoid, OMA, EggNOG |
| Zebrafish | 406353 | cdc20 | cell division cycle 20 homolog | 7955 | ZDB-GENE-040426-2044 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.