🌎 Versand an: United States
Navigation umschalten
Warenkorb
Suche
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Struktur Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

CDK4

BeschreibungCyclin-dependent kinase 4

Gene and Protein Information

Gene ID1019
Uniprot Accession IDs P11802 B2R9A0 B4DNF9 O00576 Q6FG61
Ensembl ID ENSP00000257904
Symbol CMM3 PSK-J3
FamilyBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
Sequence
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp452025CDK4cyclin dependent kinase 49598VGNC:8366OMA, EggNOG
Macaque715650CDK4cyclin dependent kinase 49544Inparanoid, OMA, EggNOG
Mouse12567Cdk4cyclin-dependent kinase 410090MGI:88357Inparanoid, OMA, EggNOG
Rat94201Cdk4cyclin-dependent kinase 410116RGD:621120Inparanoid, OMA, EggNOG
Dog481131CDK4cyclin dependent kinase 49615VGNC:39054Inparanoid, OMA
Horse100051005CDK4cyclin dependent kinase 49796VGNC:16348Inparanoid, OMA
Cow510618CDK4cyclin dependent kinase 49913Inparanoid, OMA
Pig100144492CDK4cyclin dependent kinase 49823Inparanoid, OMA
Anole lizard100559515cdk4cyclin dependent kinase 428377Inparanoid, OMA
Zebrafish777730cdk4cyclin-dependent kinase 47955ZDB-GENE-060929-974Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpezifikationenSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Dürfen wir Sie über Rabattaktionen informieren?

      Später erinnern

      Vielen Dank! Bitte überprüfen Sie Ihren E-Mail-Posteingang, um zu bestätigen.

      Hoppla! Benachrichtigungen sind deaktiviert.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.