CCND3

BeschreibungG1/S-specific cyclin-D3

Gene and Protein Information

Gene ID896
Uniprot Accession IDs P30281 B2RD63 B3KQ22 E9PAS4 E9PB36 Q5T8J0 Q6FG62 Q96F49
Ensembl ID ENSP00000362082
FamilyBelongs to the cyclin family. Cyclin D subfamily.
Sequence
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp462689CCND3cyclin D39598VGNC:11040OMA, EggNOG
Macaque695215CCND3cyclin D39544Inparanoid, OMA, EggNOG
Mouse12445Ccnd3cyclin D310090MGI:88315Inparanoid, OMA, EggNOG
Rat25193Ccnd3cyclin D310116RGD:2293Inparanoid, OMA, EggNOG
Dog608847CCND3cyclin D39615VGNC:54284Inparanoid, OMA
Horse100066590CCND3cyclin D39796VGNC:16209Inparanoid, OMA
Cow540547CCND3cyclin D39913VGNC:26964Inparanoid, OMA
Opossum100027538CCND3cyclin D313616Inparanoid, OMA
Chicken419928CCND3cyclin D39031CGNC:2542Inparanoid, OMA
Anole lizard100566165ccnd3cyclin D328377Inparanoid, OMA
C. elegans174941cyd-1G1/S-specific cyclin-D6239Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    kinase activator    /    G1/S-specific cyclin-D3
DTO Classes
protein    /    Enzyme modulator    /    Kinase modulator    /    Kinase activator    /    G1/S-specific cyclin-D3

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.