🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

GJA5

BeschreibungGap junction alpha-5 protein

Gene and Protein Information

Gene ID2702
Uniprot Accession IDs P36382 Q5T3B6 Q5U0N6
Ensembl ID ENSP00000484552
Symbol CX40 ATFB11
FamilyBelongs to the connexin family. Alpha-type (group II) subfamily.
Sequence
MGDWSFLGNFLEEVHKHSTVVGKVWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGCQNVCYDQAFPISHIRYWVLQIIFVSTPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSCWEEGNGRIALQGTLLNTYVCSILIRTTMEVGFIVGQYFIYGIFLTTLHVCRRSPCPHPVNCYVSRPTEKNVFIVFMLAVAALSLLLSLAELYHLGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Macaque701163GJA5gap junction protein alpha 59544Inparanoid, OMA
Mouse14613Gja5gap junction protein, alpha 510090MGI:95716Inparanoid, OMA
Rat50563Gja5gap junction protein, alpha 510116RGD:2692Inparanoid, OMA
Dog483155GJA5gap junction protein alpha 59615VGNC:41235Inparanoid, OMA
Horse100065052GJA5gap junction protein alpha 59796VGNC:18352Inparanoid, OMA
Cow539491GJA5gap junction protein alpha 59913VGNC:29374Inparanoid, OMA
Opossum100012487GJA5gap junction protein alpha 513616Inparanoid, OMA
Anole lizard100561629gja5gap junction protein alpha 528377Inparanoid, OMA
Xenopus100489536gja5gap junction protein alpha 58364XB-GENE-490481Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    cell junction protein    /    gap junction    /    Gap junction alpha-5 protein
DTO Classes
protein    /    Cell-cell junction    /    Gap junction    /    Gap junction alpha-5 protein

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.