🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

DENR

BeschreibungDensity-regulated protein

Gene and Protein Information

Gene ID8562
Uniprot Accession IDs O43583 Q9H3U6 Q9UKZ0 DRP
Ensembl ID ENSP00000280557
Symbol DRP1 DRP DRP1 SMAP-3
FamilyBelongs to the DENR family.
Sequence
MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Mouse68184Denrdensity-regulated protein10090MGI:1915434Inparanoid, OMA, EggNOG
Rat687565Denrdensity regulated reinitiation and release factor10116RGD:1584200Inparanoid, OMA
Dog610709DENRdensity regulated re-initiation and release factor9615VGNC:52927Inparanoid, OMA, EggNOG
Horse100060440DENRdensity regulated re-initiation and release factor9796VGNC:17131Inparanoid, OMA, EggNOG
Cow614238DENRdensity-regulated protein9913OMA, EggNOG
Pig100156971DENRdensity regulated re-initiation and release factor9823OMA, EggNOG
Opossum100016704DENRdensity regulated re-initiation and release factor13616Inparanoid, OMA, EggNOG
Platypus100075470DENRdensity regulated re-initiation and release factor9258OMA, EggNOG
Chicken771794DENRdensity regulated re-initiation and release factor9031CGNC:2776Inparanoid, OMA
Anole lizard100554171denrdensity regulated re-initiation and release factor28377Inparanoid, OMA, EggNOG
Xenopus448530denrdensity-regulated protein8364XB-GENE-1002798Inparanoid, OMA, EggNOG
Zebrafish436970denrdensity-regulated protein7955ZDB-GENE-040718-450Inparanoid, OMA, EggNOG
C. elegans176556Y47D3A.21Density-regulated protein homolog6239Inparanoid, OMA, EggNOG
Fruitfly32679DENRDensity regulated protein7227FBgn0030802Inparanoid, OMA, EggNOG
S.cerevisiae853471TMA22Tma22p4932S000003775Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    translation initiation factor    /    Density-regulated protein
protein    /    nucleic acid binding    /    nuclease    /    Density-regulated protein
DTO Classes
protein    /    Enzyme    /    Nuclease    /    Density-regulated protein

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.