🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

DGAT2

BeschreibungDiacylglycerol O-acyltransferase 2

Gene and Protein Information

Gene ID84649
Uniprot Accession IDs Q96PD7 A6ND76 Q5U810 Q68CL3 Q68DJ0 Q8NDB7 Q96BS0 Q9BYE5
Ensembl ID ENSP00000228027
Symbol ARAT HMFN1045 GS1999FULL
FamilyBelongs to the diacylglycerol acyltransferase family.
Sequence
MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLNRSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp466714DGAT2diacylglycerol O-acyltransferase 29598VGNC:3134OMA, EggNOG
Macaque696549DGAT2diacylglycerol O-acyltransferase 29544OMA, EggNOG
Mouse67800Dgat2diacylglycerol O-acyltransferase 210090MGI:1915050Inparanoid, OMA, EggNOG
Rat252900Dgat2diacylglycerol O-acyltransferase 210116RGD:620329Inparanoid, OMA, EggNOG
Dog485185DGAT2diacylglycerol O-acyltransferase 29615VGNC:39913Inparanoid, OMA, EggNOG
HorseDGAT2diacylglycerol O-acyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:16940]9796OMA, EggNOG
Cow404129DGAT2diacylglycerol O-acyltransferase 29913VGNC:28021Inparanoid, OMA, EggNOG
Opossum100011089DGAT2diacylglycerol O-acyltransferase 213616Inparanoid, OMA, EggNOG
Anole lizard100552736dgat2diacylglycerol O-acyltransferase 228377Inparanoid, OMA, EggNOG
Xenopus395003dgat2diacylglycerol O-acyltransferase 28364XB-GENE-1017054Inparanoid, OMA, EggNOG
Zebrafish565316dgat2diacylglycerol O-acyltransferase 27955ZDB-GENE-050913-15Inparanoid, OMA, EggNOG
S.cerevisiae854419DGA1diacylglycerol O-acyltransferase4932S000005771OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transferase    /    acyltransferase    /    Diacylglycerol O-acyltransferase 2
DTO Classes
protein    /    Enzyme    /    Transferase    /    Acyltransferase    /    Diacylglycerol O-acyltransferase 2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.