🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS CoA Structure
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

HSD11B1

BeschreibungCorticosteroid 11-beta-dehydrogenase isozyme 1

Gene and Protein Information

Gene ID3290
Uniprot Accession IDs P28845 B2R9Z1 D3DT89
Ensembl ID ENSP00000355995
Symbol HSD11 HSD11L SDR26C1 HDL 11-DH HSD11 HSD11B HSD11L CORTRD2 SDR26C1 11-beta-HSD1
FamilyBelongs to the short-chain dehydrogenases/reductases (SDR) family.
Sequence
MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp457698HSD11B1hydroxysteroid 11-beta dehydrogenase 19598VGNC:11453OMA, EggNOG
Mouse15483Hsd11b1hydroxysteroid 11-beta dehydrogenase 110090MGI:103562Inparanoid, OMA, EggNOG
Rat25116Hsd11b1hydroxysteroid 11-beta dehydrogenase 110116RGD:2834Inparanoid, OMA
Dog449023HSD11B1hydroxysteroid 11-beta dehydrogenase 19615VGNC:41797Inparanoid, OMA, EggNOG
Horse100056429HSD11B1hydroxysteroid 11-beta dehydrogenase 19796VGNC:18880Inparanoid, OMA, EggNOG
Cow282589HSD11B1hydroxysteroid 11-beta dehydrogenase 19913VGNC:29965Inparanoid, OMA, EggNOG
Pig397480HSD11B1hydroxysteroid 11-beta dehydrogenase 19823Inparanoid, OMA, EggNOG
Platypus100079059HSD11B1hydroxysteroid 11-beta dehydrogenase 19258Inparanoid, OMA, EggNOG
Anole lizard100555338hsd11b1hydroxysteroid 11-beta dehydrogenase 128377Inparanoid, OMA, EggNOG
Xenopus100489345hsd11b1hydroxysteroid (11-beta) dehydrogenase 18364XB-GENE-960491Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.