🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

GNB2

BeschreibungGuanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2

Gene and Protein Information

Gene ID2783
Uniprot Accession IDs P62879 B3KPU1 P11016 P54312
Ensembl ID ENSP00000305260
FamilyBelongs to the WD repeat G protein beta family.
Sequence
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp739897GNB2G protein subunit beta 29598VGNC:8684OMA, EggNOG
Mouse14693Gnb2guanine nucleotide binding protein (G protein), beta 210090MGI:95784Inparanoid, OMA
Rat81667Gnb2G protein subunit beta 210116RGD:69319Inparanoid, OMA
Horse100067486GNB2G protein subunit beta 29796VGNC:18425Inparanoid, OMA
Cow281202GNB2G protein subunit beta 29913VGNC:29459Inparanoid, OMA
Opossum100017392GNB2G protein subunit beta 213616Inparanoid, OMA
Zebrafish541370gnb2guanine nucleotide binding protein (G protein), beta polypeptide 27955ZDB-GENE-050320-65Inparanoid, OMA
C. elegans174803gpb-1G Protein, Beta subunit6239Inparanoid, OMA, EggNOG
Fruitfly32544Gbeta13FG protein beta-subunit 13F7227FBgn0001105Inparanoid, EggNOG
S.cerevisiae854387STE4G protein subunit beta4932S000005738OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    heterotrimeric G-protein    /    Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
protein    /    enzyme modulator    /    hydrolase    /    Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
DTO Classes
protein    /    Enzyme    /    Hydrolase    /    Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.