Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Cyclin-dependent kinase 17 |
|---|
Gene and Protein Information
| Gene ID | 5128 |
|---|---|
| Uniprot Accession IDs | Q00537 A8K1U6 B2RCQ2 Q8NEB8 |
| Ensembl ID | ENSP00000261211 |
| Symbol | PCTAIRE2 PCTK2 PCTK2 PCTAIRE2 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. |
| Sequence | MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRIHRRISMEDLNKRLSLPADIRIPDGYLEKLQINSPPFDQPMSRRSRRASLSEIGFGKMETYIKLEKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLTLVFEYLDKDLKQYMDDCGNIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGISSNEEFKNYNFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 452146 | CDK17 | cyclin dependent kinase 17 | 9598 | VGNC:8363 | OMA, EggNOG |
| Macaque | 717183 | CDK17 | cyclin dependent kinase 17 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 237459 | Cdk17 | cyclin-dependent kinase 17 | 10090 | MGI:97517 | Inparanoid, OMA, EggNOG |
| Rat | 314743 | Cdk17 | cyclin-dependent kinase 17 | 10116 | RGD:1565593 | Inparanoid, OMA, EggNOG |
| Horse | 100065667 | CDK17 | cyclin dependent kinase 17 | 9796 | VGNC:16343 | Inparanoid, OMA, EggNOG |
| Cow | 539655 | CDK17 | cyclin dependent kinase 17 | 9913 | VGNC:27120 | Inparanoid, OMA, EggNOG |
| Pig | 100622337 | CDK17 | cyclin dependent kinase 17 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100012745 | CDK17 | cyclin dependent kinase 17 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | CDK17 | cyclin dependent kinase 17 [Source:HGNC Symbol;Acc:HGNC:8750] | 9258 | OMA, EggNOG | ||
| Chicken | 417920 | CDK17 | cyclin dependent kinase 17 | 9031 | CGNC:8707 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100558014 | cdk17 | cyclin dependent kinase 17 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100101773 | cdk17 | cyclin-dependent kinase 17 | 8364 | XB-GENE-920552 | Inparanoid, OMA, EggNOG |
| Zebrafish | 798487 | cdk17 | cyclin-dependent kinase 17 | 7955 | ZDB-GENE-041210-15 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.