🌎 Ship to: United States
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Cholesterol 24-hydroxylase |
|---|
Gene and Protein Information
| Gene ID | 10858 |
|---|---|
| Uniprot Accession IDs | Q9Y6A2 B4DHP8 E7EQG9 Q8N2B0 CH24H |
| Ensembl ID | ENSP00000261835 |
| Symbol | CYP46 CP46 CYP46 |
| Family | Belongs to the cytochrome P450 family. |
| Sequence | MSPGLLLLGSAVLLAFGLCCTFVHRARSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVLQDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRGWQPAPPPPPC Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 453154 | CYP46A1 | cytochrome P450 family 46 subfamily A member 1 | 9598 | VGNC:7521 | OMA, EggNOG |
| Macaque | 705843 | LOC705843 | cholesterol 24-hydroxylase | 9544 | OMA, EggNOG | |
| Mouse | 13116 | Cyp46a1 | cytochrome P450, family 46, subfamily a, polypeptide 1 | 10090 | MGI:1341877 | Inparanoid, OMA, EggNOG |
| Rat | 362782 | Cyp46a1 | cytochrome P450, family 46, subfamily a, polypeptide 1 | 10116 | RGD:1306605 | Inparanoid, OMA |
| Dog | 480432 | CYP46A1 | cytochrome P450 family 46 subfamily A member 1 | 9615 | VGNC:50360 | Inparanoid, OMA, EggNOG |
| Horse | 100051131 | LOC100051131 | cholesterol 24-hydroxylase | 9796 | OMA, EggNOG | |
| Cow | CYP46A1 | cytochrome P450 family 46 subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:2641] | 9913 | OMA, EggNOG | ||
| Pig | 100512793 | LOC100512793 | cholesterol 24-hydroxylase | 9823 | Inparanoid, OMA, EggNOG | |
| Chicken | 423450 | CYP46A1 | cytochrome P450 family 46 subfamily A member 1 | 9031 | CGNC:8476 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100552607 | LOC100552607 | cholesterol 24-hydroxylase | 28377 | OMA, EggNOG | |
| Anole lizard | 100552409 | LOC100552409 | cholesterol 24-hydroxylase | 28377 | Inparanoid, OMA | |
| Xenopus | 613109 | mgc108213 | uncharacterized protein mgc108213 | 8364 | XB-GENE-969052 | OMA, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.