🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS CoA Structure
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

HSD17B2

BeschreibungEstradiol 17-beta-dehydrogenase 2

Gene and Protein Information

Gene ID3294
Uniprot Accession IDs P37059 B2R7T4
Ensembl ID ENSP00000199936
Symbol EDH17B2 SDR9C2 HSD17 SDR9C2 EDH17B2
FamilyBelongs to the short-chain dehydrogenases/reductases (SDR) family.
Sequence
MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp454269HSD17B2hydroxysteroid 17-beta dehydrogenase 29598VGNC:13715OMA, EggNOG
Mouse15486Hsd17b2hydroxysteroid (17-beta) dehydrogenase 210090MGI:1096386Inparanoid, OMA, EggNOG
Rat79243Hsd17b2hydroxysteroid (17-beta) dehydrogenase 210116RGD:621803Inparanoid, OMA, EggNOG
Dog489690HSD17B2hydroxysteroid 17-beta dehydrogenase 29615VGNC:41805Inparanoid, OMA, EggNOG
Cow515710HSD17B2hydroxysteroid 17-beta dehydrogenase 29913VGNC:29973Inparanoid, OMA, EggNOG
Opossum100031815HSD17B2hydroxysteroid 17-beta dehydrogenase 213616Inparanoid, EggNOG
Platypus100076931HSD17B2hydroxysteroid 17-beta dehydrogenase 29258Inparanoid, OMA, EggNOG
Chicken415807HSD17B2hydroxysteroid 17-beta dehydrogenase 29031CGNC:4072Inparanoid, OMA, EggNOG
Xenopushsd17b2hydroxysteroid (17-beta) dehydrogenase 2 [Source:Xenbase;Acc:XB-GENE-1011810]8364OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    dehydrogenase    /    Estradiol 17-beta-dehydrogenase 2
protein    /    oxidoreductase    /    reductase    /    Estradiol 17-beta-dehydrogenase 2
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Dehydrogenase    /    Estradiol 17-beta-dehydrogenase 2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.