Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide |
|---|
Gene and Protein Information
| Gene ID | 27071 |
|---|---|
| Uniprot Accession IDs | Q9UN19 Q8TCK5 Q9UHF2 hDAPP1 |
| Ensembl ID | ENSP00000423602 |
| Symbol | BAM32 BAM32 |
| Sequence | MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 461398 | DAPP1 | dual adaptor of phosphotyrosine and 3-phosphoinositides 1 | 9598 | VGNC:10853 | OMA, EggNOG |
| Macaque | 709038 | DAPP1 | dual adaptor of phosphotyrosine and 3-phosphoinositides 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 26377 | Dapp1 | dual adaptor for phosphotyrosine and 3-phosphoinositides 1 | 10090 | MGI:1347063 | Inparanoid, OMA, EggNOG |
| Rat | 362046 | Dapp1 | dual adaptor of phosphotyrosine and 3-phosphoinositides 1 | 10116 | RGD:1310189 | Inparanoid, OMA, EggNOG |
| Dog | 478491 | DAPP1 | dual adaptor of phosphotyrosine and 3-phosphoinositides 1 | 9615 | VGNC:39773 | Inparanoid, OMA, EggNOG |
| Horse | 100053857 | DAPP1 | dual adaptor of phosphotyrosine and 3-phosphoinositides 1 | 9796 | VGNC:17010 | Inparanoid, OMA, EggNOG |
| Cow | 533156 | DAPP1 | dual adaptor of phosphotyrosine and 3-phosphoinositides 1 | 9913 | VGNC:27880 | Inparanoid, OMA, EggNOG |
| Opossum | 100015430 | DAPP1 | dual adaptor of phosphotyrosine and 3-phosphoinositides 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | DAPP1 | dual adaptor of phosphotyrosine and 3-phosphoinositides 1 [Source:HGNC Symbol;Acc:HGNC:16500] | 9258 | OMA, EggNOG | ||
| Anole lizard | 100556013 | dapp1 | dual adaptor of phosphotyrosine and 3-phosphoinositides 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 548440 | dapp1 | dual adaptor of phosphotyrosine and 3-phosphoinositides | 8364 | XB-GENE-482064 | Inparanoid, OMA, EggNOG |
| Zebrafish | 550386 | dapp1 | dual adaptor of phosphotyrosine and 3-phosphoinositides | 7955 | ZDB-GENE-050417-180 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.