🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | C-X-C chemokine receptor type 6 |
|---|
Gene and Protein Information
| Gene ID | 10663 |
|---|---|
| Uniprot Accession IDs | O00574 O00575 Q9HCA5 CXC-R6 |
| Ensembl ID | ENSP00000395704 |
| Symbol | BONZO STRL33 TYMSTR BONZO CD186 STRL33 TYMSTR |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLILTCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVFLLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFWKLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450138 | CXCR6 | C-X-C motif chemokine receptor 6 | 9598 | VGNC:8832 | Inparanoid, OMA, EggNOG |
| Macaque | 713829 | CXCR6 | C-X-C motif chemokine receptor 6 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 80901 | Cxcr6 | chemokine (C-X-C motif) receptor 6 | 10090 | MGI:1934582 | Inparanoid, OMA, EggNOG |
| Rat | 100124593 | Cxcr6 | C-X-C motif chemokine receptor 6 | 10116 | RGD:1642118 | Inparanoid, OMA, EggNOG |
| Dog | 608840 | CXCR6 | C-X-C motif chemokine receptor 6 | 9615 | VGNC:39753 | Inparanoid, OMA, EggNOG |
| Horse | 100630558 | CXCR6 | C-X-C motif chemokine receptor 6 | 9796 | VGNC:16988 | Inparanoid, OMA, EggNOG |
| Cow | 506807 | CXCR6 | C-X-C motif chemokine receptor 6 | 9913 | VGNC:27858 | Inparanoid, OMA, EggNOG |
| Pig | 414376 | CXCR6 | C-X-C motif chemokine receptor 6 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | CXCR6 | C-X-C motif chemokine receptor 6 [Source:HGNC Symbol;Acc:HGNC:16647] | 13616 | Inparanoid, OMA, EggNOG | ||
| Anole lizard | CXCR6 | C-X-C motif chemokine receptor 6 [Source:HGNC Symbol;Acc:HGNC:16647] | 28377 | Inparanoid, OMA | ||
| Xenopus | 100491379 | cxcr6 | chemokine (C-X-C motif) receptor 6 | 8364 | XB-GENE-964706 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Chemokine receptor / C-X-C chemokine receptor / C-x-c chemokine receptor type 6
protein / G-protein coupled receptor / Class A rhodopsin like / Chemokine receptor / C-X-C chemokine receptor / C-x-c chemokine receptor type 6
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.