Toggle Nav 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | CTP synthase 1 |
|---|
Gene and Protein Information
| Gene ID | 1503 |
|---|---|
| Uniprot Accession IDs | P17812 B4DR64 D3DPW1 Q5VW67 Q96GK6 |
| Ensembl ID | ENSP00000361704 |
| Symbol | CTPS CTPS GATD5 IMD24 |
| Family | Belongs to the CTP synthase family. |
| Sequence | MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 469296 | CTPS1 | CTP synthase 1 | 9598 | VGNC:513 | OMA, EggNOG |
| Macaque | 695498 | CTPS1 | CTP synthase 1 | 9544 | OMA, EggNOG | |
| Mouse | 51797 | Ctps | cytidine 5'-triphosphate synthase | 10090 | MGI:1858304 | Inparanoid, OMA, EggNOG |
| Rat | 313560 | Ctps1 | CTP synthase 1 | 10116 | RGD:1311060 | OMA, EggNOG |
| Dog | 100687720 | CTPS1 | CTP synthase 1 | 9615 | VGNC:39704 | Inparanoid, OMA, EggNOG |
| Horse | 100053845 | CTPS1 | CTP synthase 1 | 9796 | VGNC:16943 | Inparanoid, OMA, EggNOG |
| Cow | 506131 | CTPS1 | CTP synthase 1 | 9913 | VGNC:27808 | OMA, EggNOG |
| Pig | 100525292 | CTPS1 | CTP synthase 1 | 9823 | OMA, EggNOG | |
| Opossum | 100026303 | CTPS1 | CTP synthase 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100084304 | CTPS1 | CTP synthase 1 | 9258 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100553732 | ctps1 | CTP synthase 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 445245 | ctps1b | CTP synthase 1b | 7955 | ZDB-GENE-040801-160 | Inparanoid, OMA |
| C. elegans | 189267 | ctps-1 | CTP synthase | 6239 | Inparanoid, OMA, EggNOG | |
| S.cerevisiae | 852241 | URA7 | CTP synthase URA7 | 4932 | S000000135 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.