🌎 Ship to: United States
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | DNA repair protein RAD52 homolog |
|---|
Gene and Protein Information
| Gene ID | 5893 |
|---|---|
| Uniprot Accession IDs | P43351 Q13205 Q9Y5T7 Q9Y5T8 Q9Y5T9 |
| Ensembl ID | ENSP00000351284 |
| Family | Belongs to the RAD52 family. |
| Sequence | MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRPNMALGHPQLQQVTSPSRPSHAVIPADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 466911 | RAD52 | RAD52 homolog, DNA repair protein | 9598 | VGNC:5563 | OMA, EggNOG |
| Macaque | 100426645 | RAD52 | RAD52 homolog (S. cerevisiae) | 9544 | OMA, EggNOG | |
| Mouse | 19365 | Rad52 | RAD52 homolog, DNA repair protein | 10090 | MGI:101949 | Inparanoid, OMA, EggNOG |
| Rat | 297561 | Rad52 | RAD52 homolog, DNA repair protein | 10116 | RGD:1304975 | Inparanoid, OMA, EggNOG |
| Dog | 477729 | RAD52 | RAD52 homolog, DNA repair protein | 9615 | VGNC:45321 | Inparanoid, OMA, EggNOG |
| Horse | 100050254 | RAD52 | RAD52 homolog, DNA repair protein | 9796 | VGNC:22150 | Inparanoid, OMA, EggNOG |
| Cow | 512897 | RAD52 | RAD52 homolog, DNA repair protein | 9913 | VGNC:33688 | Inparanoid, OMA, EggNOG |
| Pig | 100141308 | RAD52 | RAD52 homolog, DNA repair protein | 9823 | OMA, EggNOG | |
| Opossum | 100020944 | RAD52 | RAD52 homolog, DNA repair protein | 13616 | Inparanoid, EggNOG | |
| Xenopus | 100036666 | rad52 | RAD52 homolog, DNA repair protein | 8364 | XB-GENE-991154 | Inparanoid, EggNOG |
| Zebrafish | 554171 | rad52 | RAD52 homolog, DNA repair protein | 7955 | ZDB-GENE-050731-10 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA binding protein / DNA repair protein RAD52 homolog
protein / nucleic acid binding / DNA binding protein / DNA repair protein RAD52 homolog
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.